PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 381aa    MW: 41683.9 Da    PI: 6.4193
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025099.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.8e-33254309156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  kpr++W+peLH+rFv+a++qLGG+e+AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Pbr025099.1 254 KPRRCWSPELHRRFVDALQQLGGTEVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 309
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.065251311IPR017930Myb domain
SuperFamilySSF466891.9E-18252312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29253312IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-27254309IPR006447Myb domain, plants
PfamPF002492.0E-8256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MELLSLDSSP LFVPKTITDF LAQLAAIKDG SQRSSELDGY VKRLEDELRK IEVFKRELPL  60
CMLLLKDAIE RLKEEGMRWR RMDERPVVEE FMPLKGNSEE DGGVVSGKEN IDKKNWMSSA  120
QLWNTSINVF DYTKHDSVEL KLGNEADDRS VPESPIEVSN NRAVEGALLA FRGQNELSGF  180
AKPCLKEDKE VSEVPNLCLM TPLMSEALAG SANANSKTSN GCKGGGSGSG VAGQVKLPNK  240
PQPQPQQHQQ SLRKPRRCWS PELHRRFVDA LQQLGGTEVA TPKQIRELMQ VEGLTNDEVK  300
SHLQKYRLHI RKLPPSAAAG QGNALLMSLD HSGNHSKANN VQSGSPQGPL LAGGYAKGRS  360
TTGGESGNSR EAEEDEKSDG *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366682.10.0PREDICTED: uncharacterized protein LOC103956423 isoform X1
TrEMBLM5WFN30.0M5WFN3_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-56G2-like family protein